The URL can be used to link to this page

Home My WebLink About02/19/2013 Council Agenda Packet 1%6%2%83;2'392'-0 6)+90%6'392'-01))8-2+ 238-')%2(%+)2(% ;'MZMG'IRXIV(VMZI1EVERE%VM^SRE 'SYRGMP'LEQFIVW*IFVYEV]EXSVEJXIV41 )H,SRIE1E]SV 4EXXM'SQIVJSVH:MGI1E]SV (EZMH&S[IR'SYRGMP1IQFIV ,IVF/EM'SYRGMP1IQFIV 'EVSP1G+SVVE]'SYRGMP1IQFIV .SR4SWX'SYRGMP1IQFIV 6S\ERRI>MIKPIV'SYRGMP1IQFIV 4YVWYERXXS%67jRSXMGIMWLIVIF]KMZIRXSXLIQIQFIVWSJXLI1EVERE8S[R'SYRGMPERHXSXLI KIRIVEPTYFPMGXLEXXLI8S[R'SYRGMP[MPPLSPHEQIIXMRKSTIRXSXLITYFPMGSR*IFVYEV]EXSVEJXIV 41PSGEXIHMRXLI'SYRGMP'LEQFIVWSJXLI1EVERE1YRMGMTEP'SQTPI\;'MZMG'IRXIV(VMZI 1EVERE%VM^SRE %'8-321%=&)8%/)2&=8,)'392'-032%2=-8)10-78)(328,-7%+)2(%6IZMWMSRW MXEPMGW XSXLIEKIRHEGERSGGYVYTXSLSYVWTVMSVXSXLIQIIXMRK6IZMWIHEKIRHEMXIQWETTIEVMR %WEGSYVXIW]XSSXLIVWTPIEWIXYVRSJJSVTYXMRWMPIRXQSHIEPPTEKIVWERHGIPPTLSRIW 1IIXMRK8MQIW ;IPGSQIXSXLMW1EVERE8S[R'SYRGMPQIIXMRK6IKYPEV'SYRGMPQIIXMRKWEVIYWYEPP]LIPHXLIJMVWXERHXLMVH 8YIWHE]SJIEGLQSRXLEX41EXXLI1EVERE1YRMGMTEP'SQTPI\EPXLSYKLXLIHEXISVXMQIQE]GLERKI ERHEHHMXMSREPQIIXMRKWQE]FIGEPPIHEXSXLIVXMQIWERHSVTPEGIW'SRXEGXXLI8S[R'PIVOSV[EXGLJSV TSWXIHEKIRHEWJSVSXLIVQIIXMRKW8LMWEKIRHEQE]FIVIZMWIHYTXSLSYVWTVMSVXSXLIQIIXMRK-RWYGLE GEWIERI[EKIRHE[MPPFITSWXIHMRTPEGISJXLMWEKIRHE 7TIEOMRKEX1IIXMRKW -J]SYEVIMRXIVIWXIHMRWTIEOMRKXSXLI'SYRGMPHYVMRKXLI'EPPXSXLI4YFPMGSV4YFPMG,IEVMRKW]SYQYWXJMPP SYXEWTIEOIVGEVH PSGEXIHMRXLIPSFF]SYXWMHIXLI'SYRGMP'LEQFIVW ERHHIPMZIVMXXSXLI8S[R'PIVOTVMSV XSXLIGSRZIRMRKSJXLIQIIXMRK %PPTIVWSRWEXXIRHMRKXLI'SYRGMPQIIXMRK[LIXLIVWTIEOMRKXSXLI'SYRGMPSVRSXEVII\TIGXIHXSSFWIVZI XLI'SYRGMPVYPIWEW[IPPEWXLIVYPIWSJTSPMXIRIWWTVSTVMIX]HIGSVYQERHKSSHGSRHYGX%R]TIVWSR MRXIVJIVMRK[MXLXLIQIIXMRKMRER][E]SVEGXMRKVYHIP]SVPSYHP][MPPFIVIQSZIHJVSQXLIQIIXMRKERH[MPP RSXFIEPPS[IHXSVIXYVR %GGIWWMFMPMX] 8SFIXXIVWIVZIXLIGMXM^IRWSJ1EVEREERHSXLIVWEXXIRHMRKSYVQIIXMRKWXLI'SYRGMP'LEQFIVWEVI [LIIPGLEMVERHLERHMGETTIHEGGIWWMFPI4IVWSRW[MXLEHMWEFMPMX]QE]VIUYIWXEVIEWSREFPIEGGSQQSHEXMSR Regular Council Meeting - February 19, 2013 - Page 1 of 27 WYGLEWEWMKRPERKYEKIMRXIVTVIXIVF]GSRXEGXMRKXLI8S[R'PIVOEX 6IUYIWXWWLSYPHFI QEHIEWIEVP]EWTSWWMFPIXSEVVERKIXLIEGGSQQSHEXMSR %KIRHEW 'STMIWSJXLIEKIRHEEVIEZEMPEFPIXLIHE]SJXLIQIIXMRKMRXLIPSFF]SYXWMHIXLI'SYRGMP'LEQFIVWSVSRPMRI EX[[[QEVEREGSQ [[1168,932,3297,1044][12][,,][Arial]]F]PMROMRKXSXLI8S[R'PIVOTEKIYRHIV%KIRHEW [[3272,932,4647,1044][12][,,][Arial]]1MRYXIWERH6IGIRX%GXMSRW*SV UYIWXMSRWEFSYXXLI'SYRGMPQIIXMRKWWTIGMEPWIVZMGIWSVTVSGIHYVIWTPIEWIGSRXEGXXLI8S[R'PIVOEX 1SRHE]XLVSYKL*VMHE]JVSQ%1XS41 8LMW2SXMGIERH%KIRHE4SWXIHRSPEXIVXLER1SRHE]*IFVYEV]41EXXLI1EVERE1YRMGMTEP 'SQTPI\;'MZMG'IRXIV(VMZIXLI1EVERE3TIVEXMSRW'IRXIV;-RE6SEHERHEX [[[QEVEREGSQ [[1070,1602,3286,1714][12][,,][Arial]]SRXLI8S[R'PIVOTEKIYRHIV%KIRHEW1MRYXIWERH [[3261,1602,3950,1714][12][,,][Arial]]6IGIRX%GXMSRW 6)+90%6'392'-01))8-2+ '%008336()6%2(6300'%00 40)(+)3*%00)+-%2')-2:3'%8-32131)283*7-0)2') %4463:%03*%+)2(% '%00838,)49&0-' %XXLMWXMQIER]QIQFIVSJXLITYFPMGMWEPPS[IHXSEHHVIWWXLI8S[R'SYRGMPSRER]MWWYI[MXLMRXLI NYVMWHMGXMSRSJXLI8S[R'SYRGMPI\GITXJSVMXIQWWGLIHYPIHJSVE4YFPMG,IEVMRKEXXLMWQIIXMRK8LI WTIEOIVQE]LEZIYTXSXLVIIQMRYXIWXSWTIEO%R]TIVWSRW[MWLMRKXSEHHVIWWXLI'SYRGMPQYWX GSQTPIXIEWTIEOIVGEVHPSGEXIHSYXWMHIXLI'SYRGMP'LEQFIVWERHHIPMZIVMXXSXLI8S[R'PIVOTVMSVXS XLIGSQQIRGIQIRXSJXLIQIIXMRK-RHMZMHYEPWEHHVIWWMRKEQIIXMRKEXXLI'EPPXSXLI4YFPMG[MPPRSXFI TVSZMHIH[MXLIPIGXVSRMGXIGLRSPSK]GETEFMPMXMIWFI]SRHXLII\MWXMRKZSMGIEQTPMJMGEXMSRERHVIGSVHMRK GETEFMPMXMIWMRXLIJEGMPMXMIWERHXLI8S[RWSZIVLIEHTVSNIGXSVHSGYQIRXVIEHIV4YVWYERXXSXLI%VM^SRE 3TIR1IIXMRK0E[EXXLIGSRGPYWMSRSJ'EPPXSXLI4YFPMGMRHMZMHYEPQIQFIVWSJXLI'SYRGMPQE] VIWTSRHXSGVMXMGMWQQEHIF]XLSWI[LSLEZIEHHVIWWIHXLI'SYRGMPERHQE]EWOWXEJJXSVIZMI[XLI QEXXIVSVQE]EWOXLEXXLIQEXXIVFITPEGIHSREJYXYVIEKIRHE 463'0%1%8-327 1%=36%2('392'-06)436877911%6=3*'966)28):)287 1%2%+)6c76)43687911%6=3*'966)28):)287 46)7)28%8-327 '327)28%+)2(% 8LI'SRWIRX%KIRHEGSRXEMRWMXIQWVIUYMVMRKEGXMSRF]XLI'SYRGMP[LMGLEVIKIRIVEPP]VSYXMRIMXIQW RSXVIUYMVMRK'SYRGMPHMWGYWWMSR%WMRKPIQSXMSRERHEJJMVQEXMZIZSXI[MPPETTVSZIEPPMXIQWSRXLI 'SRWIRX%KIRHEMRGPYHMRKER]VIWSPYXMSRWSVSVHMRERGIW4VMSVXSEQSXMSRXSETTVSZIXLI'SRWIRX %KIRHEER]'SYRGMPQIQFIVQE]VIQSZIER]MXIQJVSQXLI'SRWIRX%KIRHEERHXLEXMXIQ[MPPFI HMWGYWWIHERHZSXIHYTSRWITEVEXIP] '6IWSPYXMSR2S6IPEXMRKXS'SQQYRMX](IZIPSTQIRXEYXLSVM^MRKXLI 8S[R1EREKIVXSETTP]JSVKVERXJYRHMRKJVSQXLI+SZIVRSVW3JJMGISJ,MKL[E]7EJIX] Regular Council Meeting - February 19, 2013 - Page 2 of 27 YRHIVXLI,MKL[E]7EJIX]%GXJSVXLITYVGLEWISJIUYMTQIRXERHXLIJYRHMRKSJSZIVXMQI JSVXLI1EVERE4SPMGI(ITEVXQIRXJSVJMWGEP]IEV 8:ER,SSO '6IWSPYXMSR2S6IPEXMRKXS1EVERE6IKMSREP%MVTSVXETTVSZMRKERH EYXLSVM^MRKXLI%MVTSVX1EREKIVXSI\IGYXI%TVSR9WI4IVQMX%KVIIQIRX%QIRHQIRX2S FIX[IIRXLI8S[RSJ1EVEREERH7SYXLIVR%VM^SRE7TSVXW'EV'PYF-RG .ERI*EMVEPP '6IWSPYXMSR2S6IPEXMRKXS'SQQYRMX](IZIPSTQIRXJSVQEPP] VIGSKRM^MRKERHTVSZMHMRKWYTTSVXERHEWWMWXERGIXSXLI'SQQYRMX]*SSH&ERO-RGMRMXW IJJSVXWXSERXMGMTEXIERHQIIXXLIJSSHRIIHWSJXLILYRKV]MRXLIGSQQYRMX] 8SQ)PPMW '6IWSPYXMSR2S6IPEXMRKXS9XMPMXMIWETTVSZMRKERHEYXLSVM^MRKXLI1E]SV XSI\IGYXI%QIRHQIRX2SXSXLI7PYHKI(MWTSWEP7IVZMGIW%KVIIQIRX[MXL4MQE 'SYRX] *VERO'EWWMH] 0-59360-')27)7 &3%6(7'311-77-327%2('311-88))7 '392'-0%'8-32 %6IWSPYXMSR2S6IPEXMRKXS(IZIPSTQIRXETTVSZMRKERHEYXLSVM^MRKXLI 1E]SVXSI\IGYXIXLI(IZIPSTQIRX%KVIIQIRX6IKEVHMRK4EVO(IZIPSTQIRX-QTEGX*II 'VIHMXWJSVXLI7EKYEVS&PSSQ(IZIPSTQIRX4VSNIGX *VERO'EWWMH] -8)17*36(-7'977-324377-&0)%'8-32 (6IPEXMRKXS0IKMWPEXMSRERH+SZIVRQIRX%GXMSRW(MWGYWWMSRERHTSWWMFPIEGXMSR VIKEVHMRKEPPTIRHMRKWXEXIJIHIVEPERHPSGEPPIKMWPEXMSRKSZIVRQIRXEGXMSRWERHSRVIGIRX ERHYTGSQMRKQIIXMRKWSJSXLIVKSZIVRQIRXEPFSHMIW +MPFIVX(EZMHWSR )<)'98-:)7)77-327 4YVWYERXXS%67jXLI8S[R'SYRGMPQE]ZSXIXSKSMRXSI\IGYXMZIWIWWMSR[LMGL[MPP RSXFISTIRXSXLITYFPMGXSHMWGYWWGIVXEMRQEXXIVW ))\IGYXMZI7IWWMSRTYVWYERXXS%67j % 'SYRGMPQE]EWOJSV HMWGYWWMSRSVGSRWYPXEXMSRJSVPIKEPEHZMGI[MXLXLI8S[R%XXSVRI]GSRGIVRMRKER]QEXXIV PMWXIHSRXLMWEKIRHE ))\IGYXMZIWIWWMSRTYVWYERXXS%67j % ERH JSVHMWGYWWMSRSV GSRWYPXEXMSR[MXLXLI8S[RcWEXXSVRI]WERHXSMRWXVYGXXLI8S[RcWVITVIWIRXEXMZIW GSRGIVRMRK XLIPE[WYMXIRXMXPIH4MQE'SYRX]Z8S[RSJ1EVERE1EVMGSTE'SYRX] 7YTIVMSV'SYVX2S':ERH TIRHMRKPIKEPMWWYIWWIXXPIQIRXHMWGYWWMSRW ERHGSRXVEGXRIKSXMEXMSRWVIPEXMRKXSXLIXVERWMXMSRSJ1EVERE[EWXI[EXIVGSPPIGXMSRERH XVIEXQIRXJVSQ4MQE'SYRX]XSXLI8S[RSJ1EVERE *9896)%+)2(%-8)17 2SX[MXLWXERHMRKXLIQE]SVcWHMWGVIXMSRVIKEVHMRKXLIMXIQWXSFITPEGIHSRXLIEKIRHEMJXLVIISVQSVI 'SYRGMPQIQFIVWVIUYIWXXLEXERMXIQFITPEGIHSRXLIEKIRHEMXQYWXFITPEGIHSRXLIEKIRHEJSVXLI WIGSRHVIKYPEV8S[R'SYRGMPQIIXMRKEJXIVXLIHEXISJXLIVIUYIWXTYVWYERXXS1EVERE8S[R'SHI 7IGXMSR & %(.39621)28 Regular Council Meeting - February 19, 2013 - Page 3 of 27 ;'-:-'')28)6(6-:)1%6%2%%6->32% 'SYRGMP'LEQFIVW*IFVYEV]41 1E]SVERH'SYRGMP 8S-XIQ ' 8:ER,SSO'SQQYRMX](IZIPSTQIRX(MVIGXSV *VSQ 7XVEXIKMG4PER*SGYW%VIE 2SX%TTPMGEFPI 6IWSPYXMSR2S6IPEXMRKXS'SQQYRMX](IZIPSTQIRXEYXLSVM^MRKXLI8S[R 7YFNIGX 1EREKIVXSETTP]JSVKVERXJYRHMRKJVSQXLI+SZIVRSVW3JJMGISJ,MKL[E]7EJIX]YRHIVXLI ,MKL[E]7EJIX]%GXJSVXLITYVGLEWISJIUYMTQIRXERHXLIJYRHMRKSJSZIVXMQIJSVXLI 1EVERE4SPMGI(ITEVXQIRXJSVJMWGEP]IEV (MWGYWWMSR 3ZIVXLITEWXJI[]IEVWXLIRYQFIVSJMQTEMVIHHVMZIVWSR1EVEREWXVIIXWLEWFIIRKVIEXP]VIHYGIH 1YGLSJSYVWYGGIWWMRGSQFEXMRKMQTEMVIHHVMZIVWLEWFIIREGGSQTPMWLIH[MXLXLILIPTTVSZMHIH XLVSYKLKVERXJYRHMRKJVSQXLI+SZIVRSVW3JJMGIJSV,MKL[E]7EJIX] +3,7 ERHMRGSSVHMREXMSR[MXL PSGEPERHVIKMSREPTEVXRIVWPMOIXLI7SYXLIVR%VM^SRE(9-8EWO*SVGI %PXLSYKL1EVEREMWVEROIHXLMR%VM^SREJSVTSTYPEXMSRXLI8S[RMWGYVVIRXP]WXMRXLI7XEXIJSV QSWXSZIVEPP(9-EVVIWXWERHXLJSVTIVSJJMGIVEVVIWXW-RJEGXQSVIXLER SJW[SVR14(SJJMGIVW EVI2EXMSREP,MKL[E]8VEJJMG7EJIX]%HQMRMWXVEXMSR,SVM^SRXEP+E^I2]WXEKQYWGIVXMJMIH8LI XVIQIRHSYWVIWYPXWEVIEXIWXEQIRXXSXLIHIHMGEXMSRSJSYVSJJMGIVW%PXLSYKLKVIEXWXVMHIWLEZIFIIR QEHIMRQEOMRK1EVEREcWVSEH[E]WWEJIVXLIVIEVIWXMPPEPEVKIRYQFIVSJMQTEMVIHHVMZIVWKIXXMRK FILMRHXLI[LIIPIZIV]HE]8LI1EVERE4SPMGI(ITEVXQIRXMWVIWTSRHMRKXSXLMWTVSFPIQF]MRGVIEWMRK IHYGEXMSRZMWMFMPMX]IRJSVGIQIRXERHSJJMGIVXVEMRMRK;MXLERSZIVEPPKSEPXSVIHYGIXLIRYQFIVSJ EGGMHIRXWMRNYVMIWERHHIEXLWGEYWIHF]MQTEMVIHERHEKKVIWWMZIHVMZIVWWXEJJVIUYIWXWEYXLSVM^EXMSRXS WYFQMXXLVIITVSTSWEPWXSXLI+3,7JSVKVERXJYRHMRKJSV*=EWJSPPS[W JYRHMRKJSVEHHMXMSREPSZIVXMQIHITPS]QIRXWJSVFSXLWTIIHERH(9-IRJSVGIQIRX JYRHMRKJSVXLI TYVGLEWISJTSVXEFPIFVIEXLXIWXMRKIUYMTQIRXERH JYRHMRKJSVXLITYVGLEWISJERYRQEVOIHZILMGPI -JE[EVHIHSZIVXMQIJYRHMRKJSVGSQFEXMRKMQTEMVIHHVMZIVW[MPPEPPS[1EVEREXSGSRXMRYI TEVXMGMTEXMSRSRXLI7SYXLIVR%VM^SRE(9-8EWO*SVGIMRGVIEWMRKXLIRYQFIVSJQEVOIHTEXVSPYRMXWSR XLIWXVIIXWHYVMRKTIEO(9-XMQIWERHMRXEVKIXIHPSGEXMSRW8LMWMRGVIEWIHEGXMZMX][MPPWIVZIEWE HIXIVVIRXERHF]MRGVIEWIHJSVQEPIRJSVGIQIRXEGXMSRXSVIHYGIXLIRYQFIVSJMQTEMVIHERHEKKVIWWMZI HVMZIVWSR%VM^SREVSEH[E]W8LI8S[R[MPPTVSZMHIIZIRXWTIGMJMGHITEVXQIRXMRMXMEXIHWTIIHERH (9-IRJSVGIQIRXERH[SVOMREGSSVHMREXIHIJJSVX[MXLSXLIVEKIRGMIWXSVIHYGIXLIRYQFIVSJ MRHMZMHYEPWYRHIVXLIMRJPYIRGIXLVSYKLIRJSVGIQIRXERHIHYGEXMSRIJJSVXWERHXSVIHYGIXLIRYQFIVSJ EKKVIWWMZIHVMZIVWMRXLIVIKMSR 8LI1EVERE4SPMGI(ITEVXQIRXMWEPWSVIUYIWXMRKJYRHMRKJSVTVSKVEQWEMQIHXSGSQFEXMWWYIW WYVVSYRHMRKI\GIWWMZIWTIIHERHEKKVIWWMZIHVMZMRKMRMXMEXMRKEGSSVHMREXIHIHYGEXMSRERHIRJSVGIQIRX IJJSVXYXMPM^MRKMRXIVREPVIWSYVGIWERHEPPS[XLI14(XSMRGVIEWIIJJSVXWXSVIHYGIWTIIHMRKERH Regular Council Meeting - February 19, 2013 - Page 4 of 27 EKKVIWWMZIERHMQTEMVIHHVMZMRKLIEHMRKSJJXLIFILEZMSVWXLEXPIEHXSMRGVIEWIHMRGMHIRXWSJQSXSV ZILMGPIEGGMHIRXW&]TVSEGXMZIP]EHHVIWWMRKXLIMWWYIWERHVIHYGMRKXLIFYVHIRSJEGGMHIRXMRZIWXMKEXMSR XLI14([MPPFIEFPIXSPIZIVEKIJVIIHYTQERTS[IVXSQSVIEKKVIWWMZIP]EHHVIWWXLISRKSMRK- GPSWYVIWERHMWWYIWMRWGLSSP^SRIWERHRIMKLFSVLSSHW8LIKSEPWERHSFNIGXMZIWWXEXIHMRXLIKVERXWEVI EWJSPPS[W +SEP6EMWIHVMZIVWcE[EVIRIWWEFSYXXLIWTIIHWEX[LMGLXLI]EVIHVMZMRKXLVSYKLXLI8S[RcWWGLSSP ^SRIWERHVIWMHIRXMEPWXVIIXWXLIVIF]VIHYGMRKWTIIHWERHXLITSXIRXMEPJSVXVEJJMGEGGMHIRXW 3FNIGXMZI6IHYGIWTIIHMRKGSRHMXMSRWXLVSYKLWGLSSP^SRIWERHVIWMHIRXMEPWXVIIXW 3FNIGXMZI6IHYGIWTIIHMRKGSRHMXMSRWXLVSYKLGSRWXVYGXMSR^SRIWERHGSRKIWXIHLMKLXVEJJMG EVIEW +SEP6IHYGIXLIRYQFIVSJ(9-MRGMHIRXWERHGSPPMWMSRW[MXLMRXLI8S[RSJ1EVEREERHXLIVIF] TVIWIVZIPMJIERHTVSTIVX] 3FNIGXMZIW6IHYGIXLIRYQFIVSJ(9-VIPEXIHGSPPMWMSRWMRXLIVIKMSR1EVERE[MPPFIMRMXMEXMRKE GSSVHMREXIHIHYGEXMSRERHIRJSVGIQIRXIJJSVXHYVMRKXLIOI]GSQQYXIXMQIWMRXLIEVIEWXLEX WXEXMWXMGEPP]WLS[XLILMKLIWXMRGMHIRGISJEKKVIWWMZIHVMZIVWLMKLWTIIHWERHGSPPMWMSRW8LI1EVERE 4SPMGI(ITEVXQIRXMWGSRJMHIRXXLEXF]XEOMRKXLMWX[STVSRKIHETTVSEGLJSVEHHVIWWMRKXLITVSFPIQW EWWSGMEXIH[MXLWTIIHMRKERHEKKVIWWMZIHVMZIVWMXGERVIHYGIXLIRYQFIVSJGSPPMWMSRWWIVMSYWMRNYVMIW ERHHIEXLWEQSRKMXWGMXM^IRW *MRERGMEP-QTEGX 8LI8S[R[MPPFIVIWTSRWMFPIJSVXLISTIVEXMSRQEMRXIRERGIYTHEXIWERHVITPEGIQIRXGSWXWSJXLI IUYMTQIRXTYVGLEWIH[MXLKVERXJYRHMRK(9-8EWO*SVGIJYRHMRKERH7TIIH)RJSVGIQIRXMWJSV SZIVXMQIERHIQTPS]IIVIPEXIHI\TIRWIWSRP]%R]SXLIVGSWXWVIPEXIHXSXLIEGXMZMXMIWEVIXLI8S[RW VIWTSRWMFMPMX] %88%',1)287 2EQI(IWGVMTXMSR8]TI 6IWSPYXMSRC 6IWSPYXMSR6IWSPYXMSR CJSVC+3,7C+VERXC%TTPMGEXMSRHSG 7XEJJ6IGSQQIRHEXMSR 7XEJJVIGSQQIRHWXLEXXLI1E]SVERH'SYRGMPEYXLSVM^IXLI8S[R1EREKIVXSWYFQMXKVERXETTPMGEXMSRW JSVERHI\IGYXIEPPHSGYQIRXWVIPEXIHXS+3,7JYRHMRKJSVIRJSVGIQIRXTVSKVEQWHYVMRK*= 7YKKIWXIH1SXMSR -QSZIXSEHSTX6IWSPYXMSR2SEYXLSVM^MRKXLI8S[R1EREKIVXSETTP]JSVKVERXJYRHMRK JVSQXLI+SZIVRSVW3JJMGISJ,MKL[E]7EJIX]YRHIVXLI,MKL[E]7EJIX]%GXJSVXLITYVGLEWISJ IUYMTQIRXERHXLIJYRHMRKSJSZIVXMQIJSVXLI1EVERE4SPMGI(ITEVXQIRXJSVJMWGEP]IEV Regular Council Meeting - February 19, 2013 - Page 5 of 27 MARANA RESOLUTION NO. 2013-012 RELATING TO COMMUNITY DEVELOPMENT; AUTHORIZING THE TOWN MANAGER TO APPLY FOR GRANT FUNDING FROM THE GOVER SAFETY UNDER THE HIGHWAY SAFETY ACT FOR THE PURCHASE OF EQUIPMENT AND THE FUNDING OF OVERTIME FOR THE MARANA POLICE DEPARTMENT FOR FISCAL YEAR 2013-2014 (GOHS) is seeking proposals from state and local agencies for projects relating to all aspects of highway safety; and WHEREAS the Town of Marana is interested in submitting projects to be considered for funding in the form of reimbursable grants from the National Highway Traffic Safety Administration; and WHEREAS the Town of Marana recognizes its duty to protect its citizens through effective police powers; and WHEREAS the Marana Police Department is working to increase enforcement to reduce excessive speeding and aggressive driving by drivers and the number of impaired drivers on Arizona roadways; and WHEREAS grant funding will assist the Marana Police Department in purchasing equipment related to traffic enforcement and in funding overtime pay for police officers participating in speed enforcement and Southern Arizona DUI Taskforce deployments. NOW, THEREFORE, BE IT RESOLVED BY THE MAYOR AND COUNCIL OF THE TOWN OF MARANA AS FOLLOWS: SECTION 1. The Town Manager is hereby authorized to apply for grant funding from for the purchase of portable breath testing equipment and an unmarked enforcement vehicle, and for the funding of overtime for speed and DUI deployments, for the Marana Police Department for fiscal year 2013-2014. 1 Marana Resolution 2013-012 Regular Council Meeting - February 19, 2013 - Page 6 of 27 SECTION 2. undertake all other and further tasks required or beneficial to carry out the terms, obligations, and objectives of this resolution, including the execution of all agreements, contracts and documents related to GOHS funding for the Marana Police Department during fiscal year 2013-2014. PASSED AND ADOPTED BY THE MAYOR AND COUNCIL OF THE TOWN OF th MARANA, ARIZONA, this 19 day of February 2013. ____________________________ Mayor Ed Honea ATTEST: APPROVED AS TO FORM: __________________________ ____________________________ Jocelyn C. Bronson, Town Clerk Frank Cassidy, Town Attorney 2 Marana Resolution 2013-012 Regular Council Meeting - February 19, 2013 - Page 7 of 27 ;'-:-'')28)6(6-:)1%6%2%%6->32% 'SYRGMP'LEQFIVW*IFVYEV]41 1E]SVERH'SYRGMP 8S-XIQ ' .ERI*EMVEPP(ITYX]8S[R%XXSVRI] *VSQ 7XVEXIKMG4PER*SGYW%VIE 2SX%TTPMGEFPI 6IWSPYXMSR2S6IPEXMRKXS1EVERE6IKMSREP%MVTSVXETTVSZMRKERHEYXLSVM^MRKXLI 7YFNIGX %MVTSVX1EREKIVXSI\IGYXI%TVSR9WI4IVQMX%KVIIQIRX%QIRHQIRX2SFIX[IIRXLI8S[RSJ 1EVEREERH7SYXLIVR%VM^SRE7TSVXW'EV'PYF-RG (MWGYWWMSR 3R1EVGLXLI8S[R'SYRGMPETTVSZIH6IWSPYXMSR2SEYXLSVM^MRKXLI4YFPMG;SVOW(MVIGXSV XSI\IGYXIER%TVSR9WI4IVQMX%KVIIQIRXFIX[IIRXLI8S[RERHXLI7SYXLIVR%VM^SRE7TSVXW'EV'PYF-RG JSVEWIVMIWSJRSREIVSREYXMGEPWTIGMEPIZIRXWEXXLIEMVTSVX8LEXEKVIIQIRXLEWFIIRVIRI[IHJSVERH 8LISVMKMREPEKVIIQIRXTVSZMHIWXLEXXLI'EV'PYFQYWXTVIWIRXEGIVXMJMGEXISJMRWYVERGIXSXLI8S[RREQMRK XLI8S[REWEREHHMXMSREPMRWYVIHYRHIVXLITSPMG]ERHTVSZMHMRKRSXPIWWXLERQMPPMSRMRI\GIWWYQFVIPPE PMEFMPMX]MRWYVERGIMREHHMXMSRXSEQMRMQYQSJQMPPMSRKIRIVEPPMEFMPMX]MRWYVERGITIVSGGYVVIRGI-R SFXEMRMRKMXWGIVXMJMGEXISJMRWYVERGIXLMW]IEVXLI'EV'PYFPIEVRIHXLEXXLIREXMSREPSVKERM^EXMSRYRHIV[LMGL MXSTIVEXIWLEHVIHYGIHMXWI\GIWWYQFVIPPEPMEFMPMX]GSZIVEKIJVSQQMPPMSRXSQMPPMSRERHETTVSEGLIH XLI8S[R[MXLEVIUYIWXXSVIHYGIXLIVIUYMVIQIRXWYRHIVXLISVMKMREP%TVSR9WI4IVQMX%KVIIQIRX8LI TVSTSWIHEQIRHQIRXMJETTVSZIH[MPPEQIRHXLISVMKMREPEKVIIQIRXXSVIUYMVIXLI'EV'PYFXSQEMRXEMRERH TVSHYGIIZMHIRGISJQMPPMSRMRI\GIWWYQFVIPPEPMEFMPMX]MRWYVERGIMRWXIEHSJQMPPMSR %88%',1)287 2EQI(IWGVMTXMSR8]TI 6IWSPYXMSRCCJSVC%TVSRC%MVTSVXHSG 6IWS6IWSPYXMSR %+8CC7MKRIHCEQIRHQIRXCXSC%TVSRC9WICEKXC )\LMFMX%%TVSR9WI4IVQMX%KVIIQIRX%QIRHQIRX2S)\LMFMX THJ 7XEJJ6IGSQQIRHEXMSR 8S[RWXEJJVIGSQQIRHWETTVSZEPSJXLI%TVSR9WI4IVQMX%KVIIQIRX%QIRHQIRXEWQMPPMSRMR I\GIWWYQFVIPPEPMEFMPMX]MRWYVERGIGSZIVEKIMWFIPMIZIHXSFIWYJJMGMIRXMRWYVERGIJSVXLI'EV'PYFWIZIRXW 7YKKIWXIH1SXMSR -QSZIXSEHSTX6IWSPYXMSR2SETTVSZMRKERHEYXLSVM^MRKXLI%MVTSVX1EREKIVXSI\IGYXI%TVSR 9WI4IVQMX%KVIIQIRX%QIRHQIRX2SFIX[IIRXLI8S[RSJ1EVEREERH7SYXLIVR%VM^SRE7TSVXW'EV 'PYF-RG Regular Council Meeting - February 19, 2013 - Page 8 of 27 MARANA RESOLUTION NO. 2013-013 RELATING TO MARANA REGIONAL AIRPORT; APPROVING AND AUTHORIZING THE AIRPORT MANAGER TO EXECUTE APRON USE PERMIT AGREEMENT AMENDMENT NO. 1 BETWEEN THE TOWN OF MARANA AND SOUTHERN ARIZONA SPORTS CAR CLUB, INC. WHEREAS on March 1, 2011, the Town Council adopted Resolution No. 2011-33 approving and authorizing the Public Works Director to execute an Apron Use Permit Agreement with the Southern Arizona Sports Car Club, Inc. for the purpose of allowing the Car Club to hold a series of non-aeronautical special events at the Marana Regional Airport; and WHEREAS special events conducted within the Town can enrich the quality of life within the com WHEREAS the Town Council finds that approving an amendment to the Apron Use Permit Agreement is in the best interests of the Town and its residents. NOW, THEREFORE, BE IT RESOLVED BY THE MAYOR AND COUNCIL OF THE TOWN OF MARANA, as follows: SECTION 1. The Apron Use Permit Agreement Amendment No. 1 between the Town of Ma- rana and the Southern Arizona Sports Car Club, Inc. attached to and incorporated by this reference in this resolution as Exhibit A is hereby approved, and the Airport Manager is hereby authorized to ex- ecute it for and on behalf of the Town of Marana. SECTION 2 all other and further tasks required or beneficial to carry out the terms, obligations, and objectives of this resolution. PASSED AND ADOPTED by the Mayor and Council of the Town of Marana, Arizona, th this 19 day of February, 2013. ATTEST: Mayor Ed Honea ___________________________ Jocelyn C. Bronson, Town Clerk APPROVED AS TO FORM: ___________________________ Frank Cassidy, Town Attorney Marana Resolution 2013-013 Regular Council Meeting - February 19, 2013 - Page 9 of 27 Regular Council Meeting - February 19, 2013 - Page 10 of 27 Regular Council Meeting - February 19, 2013 - Page 11 of 27 Regular Council Meeting - February 19, 2013 - Page 12 of 27 ;'-:-'')28)6(6-:)1%6%2%%6->32% 'SYRGMP'LEQFIVW*IFVYEV]41 1E]SVERH'SYRGMP 8S-XIQ ' 8SQ)PPMW4EVOWERH6IGVIEXMSR(MVIGXSV *VSQ 7XVEXIKMG4PER*SGYW%VIE 'SQQYRMX] 7XVEXIKMG4PER*SGYW%VIE%HHMXMSREP-RJSVQEXMSR 3RISJXLIJMZIJSGYWEVIEWSJXLI1EVERE7XVEXIKMG4PERMW'SQQYRMX][MXLXLISZIVEVGLMRKKSEPSJ GVIEXMRKEWEJIGSQQYRMX][LIVIEPPTISTPIEVIQSXMZEXIHXSFIMRZSPZIHERHJIIPGSRRIGXIHERHZEPYIH 6IWSPYXMSR2S6IPEXMRKXS'SQQYRMX](IZIPSTQIRXJSVQEPP]VIGSKRM^MRKERH 7YFNIGX TVSZMHMRKWYTTSVXERHEWWMWXERGIXSXLI'SQQYRMX]*SSH&ERO-RGMRMXWIJJSVXWXSERXMGMTEXI ERHQIIXXLIJSSHRIIHWSJXLILYRKV]MRXLIGSQQYRMX] (MWGYWWMSR 8LI'SQQYRMX]*SSH&EROMWE G RSXJSVTVSJMXGSVTSVEXMSR[LSWIQMWWMSRMWXSIHYGEXI EHZSGEXIEGUYMVIWXSVIERHHMWXVMFYXIJSSHXSERXMGMTEXIERHQIIXXLIJSSHRIIHWSJXLILYRKV]MRXLI GSQQYRMX]8LI8S[RSJ1EVERELEWPSRKVIGSKRM^IHXLIRIIHXSTVSQSXITVSKVEQWXLEXIRGSYVEKI WIVZMGIWJSVGMXM^IRWSJEPPEKIWERHFIKERGSSTIVEXMSR[MXLXLI'SQQYRMX]*SSH&EROMR[MXLXLI HIZIPSTQIRXSJXLI1EVERE'SQQYRMX]*SSH&ERO-RXLI8S[RVIWSPZIHXSI\IGYXIEPIEWIERH YWIEKVIIQIRX[MXLXLI'SQQYRMX]*SSH&EROJSVXLISTIVEXMSRSJXLI1EVERE0IEVRMRK*EVQEXXLI 1EVERE,IVMXEKI4EVOERSTIVEXMRKJEVQERHGSQQYRMX]VIWSYVGIJSVKEVHIRMRKGPEWWIWXLI HMWWIQMREXMSRSJMRJSVQEXMSRVIKEVHMRKJSSHTVSHYGXMSRERHWMQMPEVSTTSVXYRMXMIW-RXLI 8S[REGORS[PIHKIHXLIFIRIJMXSJXLI'SQQYRMX]*SSH&EROcWYWISJXLIJEVQERHVIWSPZIHXS GSRXMRYIXLISTIVEXMSRSJXLI1EVERE0IEVRMRK*EVQEWXLI1EVERE'SQQYRMX]*SSH&ERO*EVQ-R IGSRSQMGGSRHMXMSRWTVSLMFMXXLIGSRXMRYIHSTIVEXMSRSJXLI1EVERE'SQQYRMX]*SSH&ERO*EVQ F]XLI'SQQYRMX]*SSH&EROERHXLI*SSH&EROLEWWYFQMXXIHXSXLI8S[RJSVQEPRSXMGISJ XIVQMREXMSRSJXLIPIEWIERHYWIEKVIIQIRXEWSJ1EVGL8LI8S[RSJ1EVEREETTVIGMEXIWXLI IJJSVXWSJXLI'SQQYRMX]*SSH&EROEWMXIRLERGIHGSQQYRMX]ERH[SVOIHXSTVIWIVZITEVXSJ 1EVEREcWVMGLLIVMXEKIXLVSYKLMXW[SVOEXXLI,IVMXEKI4EVOERHGSRXMRYIH[SVOXLVSYKLXLI1EVERE 'SQQYRMX]*SSH&ERO8LITVSTSWIHVIWSPYXMSR[MPPEPPS[XLI8S[RXSJSVQEPP]XLEROXLI'SQQYRMX] *SSH&EROJSVMXWTEWXERHGSRXMRYMRKIJJSVXWERHXSTPIHKIGSRXMRYIHGSSTIVEXMSRWYTTSVXERH EWWMWXERGIFIX[IIRXLI'SQQYRMX]*SSH&EROERHXLI8S[R *MRERGMEP-QTEGX 2SRI %88%',1)287 2EQI(IWGVMTXMSR8]TI 6IWSPYXMSRC 6IWS6IWSPYXMSR CJSVC*SSHC&EROHSG Regular Council Meeting - February 19, 2013 - Page 13 of 27 7XEJJ6IGSQQIRHEXMSR 7XEJJVIGSQQIRHWETTVSZEPSJXLMWVIWSPYXMSRWYTTSVXMRKXLI'SQQYRMX]*SSH&EROXLVSYKLGSRXMRYIH GSSTIVEXMSRERHGSPPEFSVEXMSR 7YKKIWXIH1SXMSR -QSZIXSEHSTX6IWSPYXMSRJSVQEPP]VIGSKRM^MRKERHTVSZMHMRKWYTTSVXERHEWWMWXERGIXS XLI'SQQYRMX]*SSH&ERO-RGMRMXWIJJSVXWXSERXMGMTEXIERHQIIXXLIJSSHRIIHWSJXLILYRKV]MRXLI GSQQYRMX] Regular Council Meeting - February 19, 2013 - Page 14 of 27 MARANA RESOLUTION NO. 2013-014 RELATING TO COMMUNITY DEVELOPMENT; FORMALLY RECOGNIZING AND PROVIDING SUPPORT AND ASSISTANCE TO THE COMMUNITY FOOD BANK, INC. IN ITS EFFORTS TO ANTICIPATE AND MEET THE FOOD NEEDS OF THE HUNGRY IN THE COMMUNITY. W the Community Food Bank, Inc. is a non-profit HEREAS corporation whose mission is to educate, advocate, acquire, store, and distribute food to anticipate and meet the food needs of the hungry in the community; and W the Town of Marana Mayor and Council has long recognized the need to promote HEREAS programs that encourage services for citizens of all ages and began cooperation and collaboration with the Community Food Bank in 1985 with the development of the Marana Community Food Bank; and W in 2007, the Mayor and Council resolved to execute a lease and use agreement HEREAS with the Community Food Bank for the operation of the Marana Learning Farm at the Marana Herit- age River Park. The Learning Farm was intended to be an operating farm and community resource for gardening classes, the dissemination of information regarding food production, and similar op- portunities; and W in 2012, the Mayor and Council acknowledged the benefit of the Community Food HEREAS f the farm and resolved to execute a new lease and use agreement with the Community Food Bank to continue the operation of the Marana Learning Farm as the Marana Community Food Bank Farm at the Marana Heritage River Park; and Wn 2013, economic conditions prohibit the continued operation of the Marana HEREAS I Community Food Bank Farm by the Community Food Bank and the Community Food Bank has provided the Town with formal notice of its intent to terminate the lease and use agreement as of March 1, 2013; and Wthe Town of Marana appreciates the efforts of the Community Food Bank to en- HEREAS hance the Marana community Marana Heritage River Park and its continued work at the Marana Community Food Bank; and W the Town Council finds that formally recognizing and providing support and assis- HEREAS tance to the Community Food Bank in its continuing efforts to anticipate and meet the food needs of the hungry in the community is in the best interests of the Town of Marana and its citizens. N,, be it resolved by the Mayor and Council of the Town of Marana, as fol- OW THEREFORE lows: - 1 - Marana Resolution 2013-014 Regular Council Meeting - February 19, 2013 - Page 15 of 27 S1. The Marana Town Council hereby formally recognizes and thanks the Communi- ECTION ty Food Bank for its past efforts at the Marana Heritage River Park and its continued work at the Ma- rana Community Food Bank, which enhances the quality of life for citizens and visitors of Marana. S2. The Town Manager is hereby authorized, either directly or by delegation to one or ECTION more Town employees, to provide support and assistance to the Community Food Bank in its continuing efforts to educate citizens of all ages about home gardening in our desert climate and to distribute food to those in need in our community. th P by the Mayor and Council of the Town of Marana, Arizona, this 19 ASSED AND ADOPTED day of February, 2013. Mayor Ed Honea ATTEST: ___________________________ Jocelyn C. Bronson, Town Clerk APPROVED AS TO FORM: ___________________________ Frank Cassidy, Town Attorney - 2 - Marana Resolution 2013-014 Regular Council Meeting - February 19, 2013 - Page 16 of 27 ;'-:-'')28)6(6-:)1%6%2%%6->32% 'SYRGMP'LEQFIVW*IFVYEV]41 1E]SVERH'SYRGMP 8S-XIQ ' *VERO'EWWMH]8S[R%XXSVRI] *VSQ 7XVEXIKMG4PER*SGYW%VIE 2SX%TTPMGEFPI 6IWSPYXMSR2S6IPEXMRKXS9XMPMXMIWETTVSZMRKERHEYXLSVM^MRKXLI1E]SVXS 7YFNIGX I\IGYXI%QIRHQIRX2SXSXLI7PYHKI(MWTSWEP7IVZMGIW%KVIIQIRX[MXL4MQE'SYRX] (MWGYWWMSR 3R*IFVYEV]XLI'SYRGMPEHSTXIH6IWSPYXMSRETTVSZMRKE7PYHKI(MWTSWEP7IVZMGIW%KVIIQIRX [MXL4MQE'SYRX]8LIEKVIIQIRX[IRXMRXSIJJIGXSR1EVGL[LIRMX[EWWMKRIHF]XLI'LEMVQERSJ XLI4MQE'SYRX]&SEVHSJ7YTIVZMWSVW8LIEKVIIQIRXTVSZMHIHEQSRKSXLIVXLMRKWJSVXLI'SYRX]XSEGGITXERH XVIEXWPYHKI FMSWSPMHW JVSQXLI1EVERE;EWXI[EXIV6IGPEQEXMSR*EGMPMX]JSVTIVKEPPSRERHLEHERMRMXMEP XIVQSJSRI]IEV[MXLX[SSTXMSREPSRI]IEVI\XIRWMSRW 4MQE'SYRX]LEWRS[MRHMGEXIHE[MPPMRKRIWWXSI\XIRHXLIEKVIIQIRXJSVEREHHMXMSREP]IEVERHXSEGGITXE VIHYGIHTVMGISJTIVKEPPSRXSEGGITXERHXVIEXXLIWPYHKI8LMWTVSTSWIH%QIRHQIRX2SXSXLI7PYHKI (MWTSWEP7IVZMGIW%KVIIQIRXEGGSQTPMWLIWXLSWIX[SSFNIGXMZIW *MRERGMEP-QTEGX 8LMW%QIRHQIRXVITVIWIRXWEGSWXWEZMRKWSJJSYVGIRXWTIVKEPPSRSJWPYHKI[LIRGSQTEVIHXSXLISVMKMREP 7PYHKI(MWTSWEP%KVIIQIRX,S[IZIVXLI8S[RMWGYVVIRXP]LEYPMRKMXWWPYHKIXS'EWE+VERHI[LIVIXLI'MX]SJ 'EWE+VERHIMWTVSZMHMRKWPYHKIHMWTSWEPWIVZMGIWEXEWYFWXERXMEPP]PS[IVVEXI8LI8S[RWXSXEPRIXWEZMRKW VIWYPXMRKJVSQXLMW%QIRHQIRX2S[MPPHITIRHSRXLIHMJJIVIRGIMRLEYPMRKGSWXXSXLI4MQE'SYRX]HMWTSWEP PSGEXMSRZIVWYWXS'EWE+VERHIERHMWHMJJMGYPXXSTVIHMGX2IZIVXLIPIWWLEZMRKXLMW%QIRHQIRXMRTPEGIKMZIW 9XMPMXMIW(ITEVXQIRXWXEJJQE\MQYQJPI\MFMPMX]XSWIIOSYXXLIPS[IWXSZIVEPPWPYHKIHMWTSWEPGSWX %88%',1)287 2EQI(IWGVMTXMSR8]TI 6IWSPYXMSRC C4'CWPYHKICHMWTSWEPCEKVIIQIRXC 6IWSPYXMSR6IWSPYXMSR *' HSG &MSWSPMHWC%QIRHQIRXCHSG &MSWSPMHW%QIRHQIRX)\LMFMX 7XEJJ6IGSQQIRHEXMSR 7XEJJVIGSQQIRHWEHSTXMSRSJ6IWSPYXMSRETTVSZMRK%QIRHQIRX2SXSXLI7PYHKI(MWTSWEP 7IVZMGIW%KVIIQIRX[MXL4MQE'SYRX] 7YKKIWXIH1SXMSR -QSZIXSEHSTX6IWSPYXMSRETTVSZMRKERHEYXLSVM^MRKXLI1E]SVXSWMKR%QIRHQIRX2SXSXLI 7PYHKI(MWTSWEP7IVZMGIW%KVIIQIRX[MXL4MQE'SYRX] Regular Council Meeting - February 19, 2013 - Page 17 of 27 MARANA RESOLUTION NO. 2013-015 RELATING TO UTILITIES; APPROVING AND AUTHORIZING THE MAYOR TO EXECUTE AMENDMENT NO. 1 TO THE SLUDGE DISPOSAL SERVICES AGREEMENT WITH PIMA COUNTY WHEREAS the Town of Marana Resolution 2012-08 approved a Sludge Disposal Services Agreement with Pima County; and WHEREAS the initial one-year term of the Sludge Disposal Services Agreement ends on March 13, 2013; and WHEREAS Pima County has expressed a willingness to extend the Sludge Disposal Services Agreement for an additional one-year term and to reduce the per-gallon rate for sludge disposal; and WHEREAS the Mayor and Council of the Town of Marana find that this resolution is in the best interests of the Town of Marana and its citizens. NOW, THEREFORE, BE IT RESOLVED BY THE MAYOR AND COUNCIL OF THE TOWN OF MARANA, that Amendment No. 1 to the Sludge Disposal Services Agreement with Pima County attached to this resolution as Exhibit A is hereby approved, and the Mayor is authorized to execute it for and on behalf of the Town of Marana. IT IS FURTHER RESOLVED that the Town Manager and staff are hereby directed and authorized to undertake all other and further tasks required or beneficial to carry out the terms, obligations, conditions and objectives of the agreement as amended. PASSED AND ADOPTED by the Mayor and Council of the Town of Marana, Arizona, this 19th day of February, 2013. Mayor Ed Honea ATTEST: APPROVED AS TO FORM: Jocelyn C. Bronson, Town Clerk Frank Cassidy, Town Attorney Resolution No. 2013-015 2/13/2013 9:41 PM FJC Regular Council Meeting - February 19, 2013 - Page 18 of 27 PIMA COUNTY REGIONAL WASTEWATER RECLAMATION DEPARTMENT PROJECT: Sludge Disposal Services CONTRACTOR : Town of Marana CONTRACT NO.: CTN-WW-12000000000000000 514 CONTRACT AMENDMENT NO.: One (1) ORIG. CONTRACT TERM:ORIG. CONTRACT AMOUNT: 03/13/2012 03/12/2013 N/A TERMINATION DATE PRIOR AMENDMENT:PRIOR AMENDMENTS: N/A N/A TERMINATION THIS AMENDMENT: AMOUNT THIS AMENDMENT: 03/12/2014N/A REVISED CONTRACT AMOUNT: N/A CONTRACT AMENDMENT into by and between Pima County, a body politic and WHEREAS County and Town entered into a Sludge Disposal Services Agreement, Agreement Number CTN-WW-1200000 00000 00000 514 Marana Wastewater Reclamation Facility located at 14939 North Luckett Road; and WHEREAS County and Town wish to amend the Agreement to revise the per-gallon cost of sludge disposal and to extend the term. NOW, THEREFORE, the Agreement is hereby amended as follows: CHANGE : Section 4, Transportation and Payment for Treatment: point. To: point. This $0.10 per gallon rate will remain in effect unless and until the Board of Supervisors adopts an ordinance that includes a specific biosolids disposal rate. After the effective date of such ordinance, the Town shall pay the ordinance-specified rate. CHANGE: Section 8, Term and Termination, paragraph A: The term of this Agreement shall begin on the date this Agreement is last signed below and continue for a period of one year. The term of this Agreement shall begin on the date this Agreement is last signed below, and shall continue through March 12, 2014 [Remainder of page intentionally left blank.] Page 1 of 2 Revised 06/02/10 Regular Council Meeting - February 19, 2013 - Page 19 of 27 All other provisions of the Contract, not specifically changed by this Amendment, shall remain in effect and be binding upon the parties. IN WITNESS THEREOF, the parties have affixed their signatures to this Amendment on the dates written below. PIMA COUNTY: TOWN OF MARANA: _______________________________ _______________________________ Chairman, Board of Supervisors Mayor ATTEST: ATTEST: _______________________________ _______________________________ Clerk of the Board Town Clerk Date: __________________________ Date: __________________________ APPROVED AS TO CONTENT: APPROVED AS TO CONTENT: ______________________________ _______________________________ RWRD Director Utilities Director APPROVED AS TO FORM: APPROVED AS TO FORM: ______________________________ _______________________________ Deputy County Attorney Town Attorney Page 2 of 2 Revised 06/02/10 Regular Council Meeting - February 19, 2013 - Page 20 of 27 ;'-:-'')28)6(6-:)1%6%2%%6->32% 'SYRGMP'LEQFIVW*IFVYEV]41 1E]SVERH'SYRGMP 8S-XIQ % *VERO'EWWMH]8S[R%XXSVRI] *VSQ 7XVEXIKMG4PER*SGYW%VIE 2SX%TTPMGEFPI 6IWSPYXMSR2S6IPEXMRKXS(IZIPSTQIRXETTVSZMRKERHEYXLSVM^MRKXLI1E]SV 7YFNIGX XSI\IGYXIXLI(IZIPSTQIRX%KVIIQIRX6IKEVHMRK4EVO(IZIPSTQIRX-QTEGX*II'VIHMXWJSV XLI7EKYEVS&PSSQ(IZIPSTQIRX4VSNIGX (MWGYWWMSR 8S[R(IZIPSTQIRX)RKMRIIVMRKERH0IKEP(ITEVXQIRXWXEJJLEZIRIKSXMEXIHXLIXIVQWSJETEVO HIZIPSTQIRXMQTEGXJIIGVIHMXEKVIIQIRX[MXL1EVERE,SPHMRKW00'XLI+VE]LE[O(IZIPSTQIRX IRXMX]XLEXS[RWXLI7EKYEVS&PSSQHIZIPSTQIRXTVSNIGX'SRWMWXIRX[MXLXLIGVIHMXTVSZMWMSRSJXLI %VM^SREHIZIPSTQIRXMQTEGXJIIWXEXYXI %67i & ERHTVMSVEKVIIQIRXWXLMWTVSTSWIH EKVIIQIRXGEPGYPEXIWXLITEVOGVIHMXEWWSGMEXIH[MXLHIHMGEXIHTEVOPERHWFEWIHSRTIVEGVI [LMGLMWXLIEWWYQIHTIVEGVIZEPYISJPERHYWIHF]XLI8S[RJSVTYVTSWIWSJIWXEFPMWLMRKXLI HIZIPSTQIRXMQTEGXJIIJSVTEVOW %XXLIHIZIPSTIVWVIUYIWXERH[MXLXLIGSRWIRXSJXLIVIEPIWXEXIXVYWXWXLEXS[RXLIYRHIVP]MRKPERHXLI JYPPHIZIPSTQIRXMQTEGXJIIJSVTEVOW GYVVIRXP]TIVPSX [MPPFIGSPPIGXIHJSVIEGLPSXERHXLI GEPGYPEXIHGVIHMXSJTIVPSX[MPPFIVIMQFYVWIHXSXLIHIZIPSTIVJSVIEGLSJXLIERXMGMTEXIH PSXWMR7EKYEVS&PSSQ 7EKYEVS7TVMRKW &PSGOW%ERH& ;LIRXLIHIZIPSTIVGSRWXVYGXWVIUYMVIHVIKMSREPTEVOMQTVSZIQIRXWSRXLIHIHMGEXIHTEVOPERHWXLEXEVI XLIWYFNIGXSJXLMWGVIHMXEKVIIQIRXXLIHIZIPSTIVERHXLI8S[RERXMGMTEXIEQIRHMRKXLMWGVIHMX EKVIIQIRXF]YWMRKXLITEVOMQTVSZIQIRXGSRWXVYGXMSRGSWXWXSHIXIVQMRIXLIEQSYRXSJGVIHMXXSFI ETTPMIHXSXLIVIQEMRMRKTLEWIWSJXLI7EKYEVS&PSSQHIZIPSTQIRXTVSNIGX *MRERGMEP-QTEGX 8LMWGVIHMXEKVIIQIRX[MPPVIMQFYVWIXLIHIZIPSTIVEXSXEPSJSYXSJXLITVSGIIHWSJTEVO HIZIPSTQIRXMQTEGXJIIW8LMWEQSYRXMWXLIGEPGYPEXIHZEPYISJXLIEGVIWSJHIHMGEXIHTEVOPERH %88%',1)287 2EQI(IWGVMTXMSR8]TI 6IWSPYXMSRC CC7EKYEVSC&PSSQC4EVOC(-*C'VIHMXC%KVIIQIRXC 6IWS6IWSPYXMSR *' HSG %+8CC7EKYEVSC&PSSQC4EVOC(-*C'VIHMXWC )\L%XS6IWSC7EKYEVS&PSSQ4EVO(-*'VIHMX%KX)\LMFMX HSG\ Regular Council Meeting - February 19, 2013 - Page 21 of 27 7XEJJ6IGSQQIRHEXMSR 7XEJJVIGSQQIRHWEHSTXMSRSJ6IWSPYXMSRETTVSZMRKXLIHIZIPSTQIRXEKVIIQIRXVIKEVHMRK TEVOHIZIPSTQIRXMQTEGXJIIGVIHMXWJSVXLI7EKYEVS&PSSQHIZIPSTQIRXTVSNIGX 7YKKIWXIH1SXMSR -QSZIXSEHSTX6IWSPYXMSRETTVSZMRKERHEYXLSVM^MRKXLI1E]SVXSWMKRXLIHIZIPSTQIRX EKVIIQIRXVIKEVHMRKTEVOHIZIPSTQIRXMQTEGXJIIGVIHMXWJSVXLI7EKYEVS&PSSQHIZIPSTQIRXTVSNIGX Regular Council Meeting - February 19, 2013 - Page 22 of 27 MARANA RESOLUTION NO. 2013-016 RELATING TO DEVELOPMENT; APPROVING AND AUTHORIZING THE MAYOR TO EXECUTE THE DEVELOPMENT AGREEMENT REGARDING PARK DEVELOPMENT IMPACT FEE CREDITS FOR THE SAGUARO BLOOM DEVELOPMENT PROJECT WHEREAS Town of Marana staff and representatives of the owner and developer of the Saguaro Bloom development project (formerly known as Saguaro Springs) have negotiated the terms of a development agreement regarding park development impact fee credits for the Saguaro Bloom development project; and WHEREAS the Mayor and Council of the Town of Marana find that the credit agreement is consistent with state law and prior Town development impact fee credit agreements, and is in the best interests of the Town of Marana and its citizens. NOW, THEREFORE, BE IT RESOLVED BY THE MAYOR AND COUNCIL OF THE TOWN OF MARANA, that the Development Agreement Regarding Park Development Impact Fee Credits for the Saguaro Bloom Development Project attached to this resolution as Exhibit A is hereby approved, and the Mayor is authorized to execute it for and on behalf of the Town of Marana. IT IS FURTHER RESOLVED that the Town Manager and staff are hereby directed and authorized to undertake all other and further tasks required or beneficial to carry out the terms, obligations, conditions and objectives of the agreement. PASSED AND ADOPTED by the Mayor and Council of the Town of Marana, Arizona, this 19th day of February, 2013. Mayor Ed Honea ATTEST: APPROVED AS TO FORM: Jocelyn C. Bronson, Town Clerk Frank Cassidy, Town Attorney Resolution No. 2013-016 2/13/2013 10:36 PM FJC Regular Council Meeting - February 19, 2013 - Page 23 of 27 DEVELOPMENT AGREEMENT REGARDING PARK DEVELOPMENT IMPACT FEE CREDITS FOR THE SAGUARO BLOOM DEVELOPMENT PROJECT TOWN OF MARANA, ARIZONA TA(this Agreement) is entered into by and between the TM, HIS GREEMENT OWN OF ARANA , andM670H,LLC,an Arizona ARANA OLDINGS limited liability company (DeveloperThe Town and the Developer are sometimes collec- tive R ECITALS A. This Agreement is entered into and authorized pursuant to A.R.S. § 9-500.05. B. The Town has adopted certain development impact fees for roads pursuant to A.R.S. § 9-463.05. C. The Developer is the current master developer of the lands described and depicted on 58 of Maps and Plats, Page 23 Saguaro Springs Block 4); at Book 62 of Maps and Plats, Page 7 (Saguaro Springs Block 8A); and at Book 62 of Maps and Plats, Page 8 as modified by the partial replat at Sequence No. 20123610307 (col- Saguaro Springs Block 8B) Bloom Development Project. D. Title to the lots in Saguaro Springs Block 4 and Saguaro Springs Block 8A is held by FATIC, a California corporation, as trustee under Trust IRST MERICAN ITLE NSURANCE OMPANY Nos. 8692, and not personally. E. Title to the lots in Saguaro Springs Block 8B is held by FATI IRST MERICAN ITLE N- C, a California corporation, as trustee under Trust No. 9140, and not personal- SURANCE OMPANY ly. F. The Developer is entitled to credit pursuant to A.R.S. § 9-463.05(B)(10) toward the parks development impact fees based on the required dedication of a public park site and improvements provided or to be provided by the Developer in connec- tion with the development of Saguaro Bloom. G. value of $30,000 per acre. H. The Parties desire to memorialize their agreement concerning the amount and admin- istration of the development impact fee credit. - 1 - {00032922.DOCX / 3} 2/6/2013 8:55 AM Regular Council Meeting - February 19, 2013 - Page 24 of 27 A GREEMENT N,, in consideration of the foregoing premises and the mutual covenants set OW THEREFORE forth in this Agreement, the Parties hereby agree as follows: 1.Credit toward park development impact fees. 1.1. Total value. The Deveacres of park land in what is now Saguaro Bloom, of which 90% is considered appropriate and useable for active recreation. The remaining 10% of the dedication is primarily for drainage purposes. This yields a net dedication for park improvements of 26.1 acres with a value of $783,000. 1.2. Credited lots. The Developer chooses to apply the credits for the benefitting park land dedication only to the residential lots in Saguaro Springs Block 4, Saguaro Springs Block 8A, and Saguaro Springs Block 8B (collectively, The Developer an- ticipates that 607 total residential lots will be constructed in Saguaro Bloom Phase One. 1.3. Credit per lot. The credit against park development impact fees in Saguaro Bloom Phase One is $1,290 per lot. 1.4. Reimbursement of Credits. On or before January 31 and July 31 of each year, the Town shall reimburse the Developer $1,290 for each single family residential building permit issued in Saguaro Bloom Phase One for park development impact fees actually collected by the Town dur- ing each six-month period ending December 31 and June 30 respectively. 1.5. Future phases. Upon construction of the required regional park im- provements, the Developer and the Town agree to amend this Agreement to utilize the benefit- ting construction costs to generate a credit for remaining phases of Saguaro Bloom. When the amendment is prepared, the Developer may also make a final measurement of the active park area of the park dedication referred to in subparagraph 1.1 above to determine if the Developer is entitled to additional credit for the park dedication. 2.Miscellaneous 2.1. Binding effect. This Agreement shall be binding upon and inure to the benefit of the heirs, executors, administrators, successors and assigns of the Parties. 2.2. Cancellation for conflict of interest. This Agreement is subject to A.R.S. § 38-511, which provides for cancellation in certain instances involving conflict of interest. 2.3. Counterparts. This Agreement may be executed in two or more counterparts, each of which shall be deemed an original, but all of which together shall constitute one and the same instrument. The signature pages from one or more counterparts may be removed from such coun- terparts and such signature pages all attached to a single instrument so that the signatures of all Parties may be physically attached to a single document. 2.4. Good standing: authority. The Developer represents and warrants to the Town that it is duly formed and validly existing and authorized to do business in the state of Arizona. The Town represents and warrants to the Developer that it is an Arizona municipal corporation with au- thority to enter into this Agreement under applicable state laws. Each Party represents and war- rants that the individual executing this Agreement on its behalf is authorized and empowered to bind the Party on whose behalf each such individual is signing. - 2 - {00032922.DOCX / 3} 2/6/2013 8:55 AM Regular Council Meeting - February 19, 2013 - Page 25 of 27 2.5. Governing law. This Agreement is entered into in Arizona and shall be construed and in- terpreted under the laws of the State of Arizona, and the Parties agree that any litigation or arbi- tration shall take place in Pima County, Arizona. 2.6. Interpretation. This Agreement has been negotiated by the Parties, and no Party shall be deemed to have drafted this Agreement for purposes of construing any portion of this Agreement for or against any Party. I, the Parties have executed this Agreement as of the last date set forth N WITNESS WHEREOF below their respective signatures. Developer TM, an Arizona municipal M670H,LLC, an Arizona limited OWN OF ARANAARANA OLDINGS corporation liability company By: TPD,I., an WIN EAKS EVELOPMENT NC Arizona corporation, sole member By: Ed Honea, Mayor Date: Brian Baehr, Vice President A: Date: TTEST Jocelyn C. Bronson, Clerk AF: PPROVED AS TO ORM Frank Cassidy, Town Attorney C: ONSENT GRANTED BY THE UNDERSIGNED PROPERTY OWNERS FATIFATIC, a IRST MERICAN ITLE NSURANCE IRST MERICAN ITLE NSURANCE OMPANY C, a California corporation, as trustee California corporation, as trustee under Trust OMPANY under Trust No. 8692, and not personally No. 9140, and not personally By: By: Name: Name: Date: Date: - 3 - {00032922.DOCX / 3} 2/6/2013 8:55 AM Regular Council Meeting - February 19, 2013 - Page 26 of 27 SA ) TATE OF RIZONA ss County of ) The foregoing instrument was acknowledged before me on by Brian Baehr, Vice President of TPD,I., an Arizona corporation, sole member WIN EAKS EVELOPMENT NC of M670H, LLC an Arizona limited liability company, on behalf of the LLC. ARANA OLDINGS (Seal) Notary Public S ) TATE OF ss County of ) The foregoing instrument was acknowledged before me on __________________________ by ______________________________, the _____________________ of FAT IRST MERICAN ITLE IC, a California corporation, as trustee under Trust No. 8692, and not NSURANCE OMPANY personally, on behalf of the trust. (Seal) Notary Public S ) TATE OF ss County of ) The foregoing instrument was acknowledged before me on __________________________ by ______________________________, the _____________________ of FAT IRST MERICAN ITLE IC, a California corporation, as trustee under Trust No. 9140, and not NSURANCE OMPANY personally, on behalf of the trust. (Seal) Notary Public - 4 - {00032922.DOCX / 3} 2/6/2013 8:55 AM Regular Council Meeting - February 19, 2013 - Page 27 of 27